![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
![]() | Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (8 PDB entries) |
![]() | Domain d3bowb_: 3bow B: [208685] automated match to d1df0b_ complexed with ca |
PDB Entry: 3bow (more details), 2.4 Å
SCOPe Domain Sequences for d3bowb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bowb_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]} seeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsd ttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmii rrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
Timeline for d3bowb_: