| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
| Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
| Protein automated matches [191074] (6 species) not a true protein |
| Species Synechocystis sp. [TaxId:1143] [225417] (1 PDB entry) |
| Domain d3bn4c_: 3bn4 C: [208681] automated match to d3sssf_ complexed with so4 |
PDB Entry: 3bn4 (more details), 2 Å
SCOPe Domain Sequences for d3bn4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bn4c_ d.58.56.1 (C:) automated matches {Synechocystis sp. [TaxId: 1143]}
iavgmietlgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpiryt
Timeline for d3bn4c_: