Lineage for d3bn4a_ (3bn4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562705Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2562739Protein automated matches [191074] (7 species)
    not a true protein
  7. 2562763Species Synechocystis sp. [TaxId:1143] [225417] (1 PDB entry)
  8. 2562764Domain d3bn4a_: 3bn4 A: [208679]
    automated match to d3sssf_
    complexed with so4

Details for d3bn4a_

PDB Entry: 3bn4 (more details), 2 Å

PDB Description: carboxysome subunit, ccmk1
PDB Compounds: (A:) Carbon dioxide-concentrating mechanism protein ccmK homolog 1

SCOPe Domain Sequences for d3bn4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bn4a_ d.58.56.1 (A:) automated matches {Synechocystis sp. [TaxId: 1143]}
iavgmietlgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpiryt

SCOPe Domain Coordinates for d3bn4a_:

Click to download the PDB-style file with coordinates for d3bn4a_.
(The format of our PDB-style files is described here.)

Timeline for d3bn4a_: