Lineage for d3bmoc_ (3bmo C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827294Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 1827357Species Trypanosoma brucei [TaxId:5702] [226783] (9 PDB entries)
  8. 1827360Domain d3bmoc_: 3bmo C: [208673]
    automated match to d1p33a_
    complexed with act, ax4, d1d, dtt, gol, na, nap

Details for d3bmoc_

PDB Entry: 3bmo (more details), 1.6 Å

PDB Description: Structure of Pteridine Reductase 1 (PTR1) from Trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor (Compound AX4)
PDB Compounds: (C:) pteridine reductase

SCOPe Domain Sequences for d3bmoc_:

Sequence, based on SEQRES records: (download)

>d3bmoc_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqva
eligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhal
vgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadav
iflvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d3bmoc_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgktvetqvaeligtnai
apflltmsfaqrqkssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapyg
irvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsi
ikvdgglslvha

SCOPe Domain Coordinates for d3bmoc_:

Click to download the PDB-style file with coordinates for d3bmoc_.
(The format of our PDB-style files is described here.)

Timeline for d3bmoc_: