SCOP 1.73: Domain d1igtb2: 1igt B:115-235

Lineage for d1igtb2 (1igt B:115-235)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1igtb2: 1igt B:115-235 [20867]
   Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb3, d1igtb4, d1igtc1, d1igtc2, d1igtd1, d1igtd3, d1igtd4

Details for d1igtb2

PDB Entry: 1igt, 2.8 Å

PDB Description: structure of immunoglobulin

PDB Compounds: (B:) igg2a intact antibody - mab231

SCOP Domain Sequences for d1igtb2:

Sequence; same for both SEQRES and ATOM records:

>d1igtb2 b.1.1.2 (B:115-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptik

Timeline for d1igtb2:

• d1igtb2 first appeared (with stable ids) in SCOP 1.55
  
• d1igtb2 appears in SCOP 1.71
  
• d1igtb2 appears in SCOP 1.75
  
• d1igtb2 appears in the current release, SCOPe 2.08