SCOPe 2.08: Domain d3bm5a1: 3bm5 A:2-337

Lineage for d3bm5a1 (3bm5 A:2-337)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (38 species)
   not a true protein

7. Species Entamoeba histolytica [TaxId:294381] [225437] (5 PDB entries)

8. Domain d3bm5a1: 3bm5 A:2-337 [208660]
   Other proteins in same PDB: d3bm5a2
   automated match to d3spxa_
   complexed with cys, plp, so4

Details for d3bm5a1

PDB Entry: 3bm5, 2.4 Å

PDB Description: Crystal structure of O-acetyl-serine sulfhydrylase from Entamoeba histolytica in complex with cysteine

PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d3bm5a1:

Sequence; same for both SEQRES and ATOM records:

>d3bm5a1 c.79.1.0 (A:2-337) automated matches {Entamoeba histolytica [TaxId: 294381]}
eqisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdrv
gfnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmimk
afgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedtd
gevdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigagf
ipdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegkt
iviivpscgerylstdlykikdegtkiqildsllne

Timeline for d3bm5a1:

• d3bm5a1 first appeared in SCOPe 2.03, called d3bm5a_
  
• d3bm5a1 appears in SCOPe 2.07