SCOPe 2.07: Domain d3blka2: 3blk A:404-496

Lineage for d3blka2 (3blk A:404-496)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (55 PDB entries)
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d3blka2: 3blk A:404-496 [208656]
   Other proteins in same PDB: d3blka1
   automated match to d1jfha1
   complexed with ca, cl, hmc

Details for d3blka2

PDB Entry: 3blk, 2 Å

PDB Description: role of aromatic residues in starch binding

PDB Compounds: (A:) Alpha-amylase 1

SCOPe Domain Sequences for d3blka2:

Sequence; same for both SEQRES and ATOM records:

>d3blka2 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d3blka2:

• d3blka2 first appeared in SCOPe 2.03
  
• d3blka2 appears in SCOPe 2.06
  
• d3blka2 appears in the current release, SCOPe 2.08