Lineage for d3bjud2 (3bju D:222-575)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208934Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2208935Protein automated matches [226887] (13 species)
    not a true protein
  7. 2208972Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries)
  8. 2208978Domain d3bjud2: 3bju D:222-575 [208654]
    Other proteins in same PDB: d3bjua1, d3bjub1, d3bjuc1, d3bjud1
    automated match to d1bbua2
    complexed with atp, ca, lys

Details for d3bjud2

PDB Entry: 3bju (more details), 2.31 Å

PDB Description: crystal structure of tetrameric form of human lysyl-trna synthetase
PDB Compounds: (D:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3bjud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjud2 d.104.1.0 (D:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

SCOPe Domain Coordinates for d3bjud2:

Click to download the PDB-style file with coordinates for d3bjud2.
(The format of our PDB-style files is described here.)

Timeline for d3bjud2: