Lineage for d3bjuc1 (3bju C:72-221)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1315558Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1315559Protein automated matches [190576] (18 species)
    not a true protein
  7. 1315589Species Human (Homo sapiens) [TaxId:9606] [225402] (5 PDB entries)
  8. 1315596Domain d3bjuc1: 3bju C:72-221 [208651]
    Other proteins in same PDB: d3bjua2, d3bjub2, d3bjuc2, d3bjud2
    automated match to d1bbua1
    complexed with atp, ca, lys

Details for d3bjuc1

PDB Entry: 3bju (more details), 2.31 Å

PDB Description: crystal structure of tetrameric form of human lysyl-trna synthetase
PDB Compounds: (C:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3bjuc1:

Sequence, based on SEQRES records: (download)

>d3bjuc1 b.40.4.0 (C:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphlhfglk

Sequence, based on observed residues (ATOM records): (download)

>d3bjuc1 b.40.4.0 (C:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphglk

SCOPe Domain Coordinates for d3bjuc1:

Click to download the PDB-style file with coordinates for d3bjuc1.
(The format of our PDB-style files is described here.)

Timeline for d3bjuc1: