SCOPe 2.03: Domain d3bjub2: 3bju B:223-574

Lineage for d3bjub2 (3bju B:223-574)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (4 PDB entries)

8. Domain d3bjub2: 3bju B:223-574 [208650]
   Other proteins in same PDB: d3bjua1, d3bjub1, d3bjuc1, d3bjud1
   automated match to d1bbua2
   complexed with atp, ca, lys

Details for d3bjub2

PDB Entry: 3bju, 2.31 Å

PDB Description: crystal structure of tetrameric form of human lysyl-trna synthetase

PDB Compounds: (B:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3bjub2:

Sequence; same for both SEQRES and ATOM records:

>d3bjub2 d.104.1.0 (B:223-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavakp
fityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefym
ayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveelek
algmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptfi
cdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaag
ddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamk

Timeline for d3bjub2:

• d3bjub2 is new in SCOPe 2.03-stable
  
• d3bjub2 appears in SCOPe 2.04
  
• d3bjub2 appears in the current release, SCOPe 2.08