Lineage for d3bjub2 (3bju B:223-574)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (15 species)
    not a true protein
  7. 2532983Species Human (Homo sapiens) [TaxId:9606] [225403] (9 PDB entries)
  8. 2532991Domain d3bjub2: 3bju B:223-574 [208650]
    Other proteins in same PDB: d3bjua1, d3bjub1, d3bjuc1, d3bjud1
    automated match to d1bbua2
    complexed with atp, ca, lys

Details for d3bjub2

PDB Entry: 3bju (more details), 2.31 Å

PDB Description: crystal structure of tetrameric form of human lysyl-trna synthetase
PDB Compounds: (B:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3bjub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjub2 d.104.1.0 (B:223-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavakp
fityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefym
ayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveelek
algmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptfi
cdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaag
ddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamk

SCOPe Domain Coordinates for d3bjub2:

Click to download the PDB-style file with coordinates for d3bjub2.
(The format of our PDB-style files is described here.)

Timeline for d3bjub2: