| Class b: All beta proteins [48724] (177 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
| Protein automated matches [190576] (33 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225402] (8 PDB entries) |
| Domain d3bjub1: 3bju B:72-214 [208649] Other proteins in same PDB: d3bjua2, d3bjub2, d3bjuc2, d3bjud2 automated match to d1bbua1 complexed with atp, ca, lys |
PDB Entry: 3bju (more details), 2.31 Å
SCOPe Domain Sequences for d3bjub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bjub1 b.40.4.0 (B:72-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlp
Timeline for d3bjub1: