SCOPe 2.07: Domain d3bhdb_: 3bhd B:

Lineage for d3bhdb_ (3bhd B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.2: CYTH domain [118007] (5 proteins)
   Pfam PF01928

6. Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [194539] (2 PDB entries)

8. Domain d3bhdb_: 3bhd B: [208646]
   automated match to d2jmua1
   complexed with cit, cl, gol, na, so4

Details for d3bhdb_

PDB Entry: 3bhd, 1.5 Å

PDB Description: Crystal structure of human thiamine triphosphatase (THTPA)

PDB Compounds: (B:) Thiamine triphosphatase

SCOPe Domain Sequences for d3bhdb_:

Sequence; same for both SEQRES and ATOM records:

>d3bhdb_ d.63.1.2 (B:) Thiamine-triphosphatase (ThTPase) {Human (Homo sapiens) [TaxId: 9606]}
qglieverkflpgpgteerlqelggtleyrvtfrdtyydtpelslmqadhwlrrredsgw
elkcpgaagvlgphteykeltaeptivaqlckvlradglgagdvaavlgplglqevasfv
tkrsawklvllgadeeepqlrvdldtadfgyavgevealvheeaevptalekihrlssml
gvpaqetapaklivylqrfrpqdyqr

Timeline for d3bhdb_:

• d3bhdb_ first appeared in SCOPe 2.03
  
• d3bhdb_ appears in SCOPe 2.06
  
• d3bhdb_ appears in the current release, SCOPe 2.08