![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
![]() | Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) ![]() |
![]() | Family d.63.1.2: CYTH domain [118007] (5 proteins) Pfam PF01928 |
![]() | Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [194539] (2 PDB entries) |
![]() | Domain d3bhdb_: 3bhd B: [208646] automated match to d2jmua1 complexed with cit, cl, gol, na, so4 |
PDB Entry: 3bhd (more details), 1.5 Å
SCOPe Domain Sequences for d3bhdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bhdb_ d.63.1.2 (B:) Thiamine-triphosphatase (ThTPase) {Human (Homo sapiens) [TaxId: 9606]} qglieverkflpgpgteerlqelggtleyrvtfrdtyydtpelslmqadhwlrrredsgw elkcpgaagvlgphteykeltaeptivaqlckvlradglgagdvaavlgplglqevasfv tkrsawklvllgadeeepqlrvdldtadfgyavgevealvheeaevptalekihrlssml gvpaqetapaklivylqrfrpqdyqr
Timeline for d3bhdb_: