Lineage for d3bfra2 (3bfr A:99-213)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225565] (1 PDB entry) 
Domain d3bfra2: 3bfr A:99-213 [208641]
Other proteins in same PDB: d3bfra1
automated match to d1kkca2
complexed with mn3
Details for d3bfra2
PDB Entry: 3bfr (more details), 2.05 Å
PDB Description: The crystal structure of Sod2 from Saccharomyces cerevisiae
PDB Compounds: (A:) Superoxide dismutase [Mn]SCOPe Domain Sequences for d3bfra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bfra2 d.44.1.1 (A:99-213) Mn superoxide dismutase (MnSOD) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdag
SCOPe Domain Coordinates for d3bfra2:
Click to download the PDB-style file with coordinates for d3bfra2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bfra2:
- d3bfra2 first appeared in SCOPe 2.03
- d3bfra2 appears in SCOPe 2.07
View in 3D
