Lineage for d3bfra2 (3bfr A:99-213)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946129Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2946140Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225565] (1 PDB entry)
  8. 2946141Domain d3bfra2: 3bfr A:99-213 [208641]
    Other proteins in same PDB: d3bfra1
    automated match to d1kkca2
    complexed with mn3

Details for d3bfra2

PDB Entry: 3bfr (more details), 2.05 Å

PDB Description: The crystal structure of Sod2 from Saccharomyces cerevisiae
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3bfra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bfra2 d.44.1.1 (A:99-213) Mn superoxide dismutase (MnSOD) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdag

SCOPe Domain Coordinates for d3bfra2:

Click to download the PDB-style file with coordinates for d3bfra2.
(The format of our PDB-style files is described here.)

Timeline for d3bfra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bfra1