SCOPe 2.08: Domain d3bfra1: 3bfr A:9-98

Lineage for d3bfra1 (3bfr A:9-98)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225564] (1 PDB entry)

8. Domain d3bfra1: 3bfr A:9-98 [208640]
   Other proteins in same PDB: d3bfra2
   automated match to d1kkca1
   complexed with mn3

Details for d3bfra1

PDB Entry: 3bfr, 2.05 Å

PDB Description: The crystal structure of Sod2 from Saccharomyces cerevisiae

PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3bfra1:

Sequence; same for both SEQRES and ATOM records:

>d3bfra1 a.2.11.1 (A:9-98) Mn superoxide dismutase (MnSOD) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap

Timeline for d3bfra1:

• d3bfra1 first appeared in SCOPe 2.03
  
• d3bfra1 appears in SCOPe 2.07