| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225564] (1 PDB entry) |
| Domain d3bfra1: 3bfr A:9-98 [208640] Other proteins in same PDB: d3bfra2 automated match to d1kkca1 complexed with mn3 |
PDB Entry: 3bfr (more details), 2.05 Å
SCOPe Domain Sequences for d3bfra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bfra1 a.2.11.1 (A:9-98) Mn superoxide dismutase (MnSOD) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap
Timeline for d3bfra1: