![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88614] (1 PDB entry) |
![]() | Domain d1exua1: 1exu A:177-267 [20864] Other proteins in same PDB: d1exua2, d1exub_ complexed with bme |
PDB Entry: 1exu (more details), 2.7 Å
SCOPe Domain Sequences for d1exua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exua1 b.1.1.2 (A:177-267) Fc (IgG) receptor, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha sssltvksgdehhyccivqhaglaqplrvel
Timeline for d1exua1: