Lineage for d3bfgb_ (3bfg B:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450680Species Citrobacter sedlakii [TaxId:67826] [188289] (5 PDB entries)
  8. 1450690Domain d3bfgb_: 3bfg B: [208637]
    automated match to d3bffd_
    complexed with mer

Details for d3bfgb_

PDB Entry: 3bfg (more details), 2 Å

PDB Description: class a beta-lactamase sed-g238c complexed with meropenem
PDB Compounds: (B:) Class A beta-lactamase Sed1

SCOPe Domain Sequences for d3bfgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bfgb_ e.3.1.1 (B:) automated matches {Citrobacter sedlakii [TaxId: 67826]}
vqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqset
hdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggpg
nvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqraq
lvdwlkgnttggqsiraglpahwvvgdktgacdygttndiaviwpedraplvlvtyftqp
qqdakwrkdvlaaaakivtegk

SCOPe Domain Coordinates for d3bfgb_:

Click to download the PDB-style file with coordinates for d3bfgb_.
(The format of our PDB-style files is described here.)

Timeline for d3bfgb_: