Lineage for d3bfcc_ (3bfc C:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013619Species Citrobacter sedlakii [TaxId:67826] [188289] (5 PDB entries)
  8. 3013634Domain d3bfcc_: 3bfc C: [208634]
    automated match to d3bffd_
    complexed with im2

Details for d3bfcc_

PDB Entry: 3bfc (more details), 2.2 Å

PDB Description: class A beta-lactamase SED-G238C complexed with imipenem
PDB Compounds: (C:) Class A beta-lactamase Sed1

SCOPe Domain Sequences for d3bfcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bfcc_ e.3.1.1 (C:) automated matches {Citrobacter sedlakii [TaxId: 67826]}
vqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqset
hdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggpg
nvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqraq
lvdwlkgnttggqsiraglpahwvvgdktgacdygttndiaviwpedraplvlvtyftqp
qqdakwrkdvlaaaakivtegk

SCOPe Domain Coordinates for d3bfcc_:

Click to download the PDB-style file with coordinates for d3bfcc_.
(The format of our PDB-style files is described here.)

Timeline for d3bfcc_: