Lineage for d3beoa1 (3beo A:1-371)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911069Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225410] (1 PDB entry)
  8. 2911070Domain d3beoa1: 3beo A:1-371 [208630]
    Other proteins in same PDB: d3beoa2, d3beob2
    automated match to d1f6dc_
    complexed with ud1, udp

Details for d3beoa1

PDB Entry: 3beo (more details), 1.7 Å

PDB Description: A Structural Basis for the allosteric regulation of non-hydrolyzing UDP-GlcNAc 2-epimerases
PDB Compounds: (A:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d3beoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3beoa1 c.87.1.0 (A:1-371) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mterlkvmtifgtrpeaikmaplvlelqkhpekiesivtvtaqhrqmldqvlsifgitpd
fdlnimkdrqtlidittrglegldkvmkeakpdivlvhgdttttfiaslaafynqipvgh
veaglrtwdkyspypeemnrqltgvmadlhfsptaksatnlqkenkdesrifitgntaid
alkttvketyshpvleklgnnrlvlmtahrrenlgepmrnmfraikrlvdkhedvqvvyp
vhmnpvvretandilgdygrihliepldvidfhnvaarsylmltdsggvqeeapslgvpv
lvlrdtterpegieagtlklagtdeetifsladellsdkeahdkmskasnpygdgraser
iveailkhfnk

SCOPe Domain Coordinates for d3beoa1:

Click to download the PDB-style file with coordinates for d3beoa1.
(The format of our PDB-style files is described here.)

Timeline for d3beoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3beoa2