![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) ![]() |
![]() | Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
![]() | Protein automated matches [190965] (40 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225410] (1 PDB entry) |
![]() | Domain d3beoa1: 3beo A:1-371 [208630] Other proteins in same PDB: d3beoa2, d3beob2 automated match to d1f6dc_ complexed with ud1, udp |
PDB Entry: 3beo (more details), 1.7 Å
SCOPe Domain Sequences for d3beoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3beoa1 c.87.1.0 (A:1-371) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mterlkvmtifgtrpeaikmaplvlelqkhpekiesivtvtaqhrqmldqvlsifgitpd fdlnimkdrqtlidittrglegldkvmkeakpdivlvhgdttttfiaslaafynqipvgh veaglrtwdkyspypeemnrqltgvmadlhfsptaksatnlqkenkdesrifitgntaid alkttvketyshpvleklgnnrlvlmtahrrenlgepmrnmfraikrlvdkhedvqvvyp vhmnpvvretandilgdygrihliepldvidfhnvaarsylmltdsggvqeeapslgvpv lvlrdtterpegieagtlklagtdeetifsladellsdkeahdkmskasnpygdgraser iveailkhfnk
Timeline for d3beoa1: