SCOPe 2.08: Domain d3beoa1: 3beo A:1-371

Lineage for d3beoa1 (3beo A:1-371)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.0: automated matches [191559] (1 protein)
   not a true family

6. Protein automated matches [190965] (40 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225410] (1 PDB entry)

8. Domain d3beoa1: 3beo A:1-371 [208630]
   Other proteins in same PDB: d3beoa2, d3beob2
   automated match to d1f6dc_
   complexed with ud1, udp

Details for d3beoa1

PDB Entry: 3beo, 1.7 Å

PDB Description: A Structural Basis for the allosteric regulation of non-hydrolyzing UDP-GlcNAc 2-epimerases

PDB Compounds: (A:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d3beoa1:

Sequence; same for both SEQRES and ATOM records:

>d3beoa1 c.87.1.0 (A:1-371) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mterlkvmtifgtrpeaikmaplvlelqkhpekiesivtvtaqhrqmldqvlsifgitpd
fdlnimkdrqtlidittrglegldkvmkeakpdivlvhgdttttfiaslaafynqipvgh
veaglrtwdkyspypeemnrqltgvmadlhfsptaksatnlqkenkdesrifitgntaid
alkttvketyshpvleklgnnrlvlmtahrrenlgepmrnmfraikrlvdkhedvqvvyp
vhmnpvvretandilgdygrihliepldvidfhnvaarsylmltdsggvqeeapslgvpv
lvlrdtterpegieagtlklagtdeetifsladellsdkeahdkmskasnpygdgraser
iveailkhfnk

Timeline for d3beoa1:

• d3beoa1 first appeared in SCOPe 2.03, called d3beoa_
  
• d3beoa1 appears in SCOPe 2.07