SCOPe 2.08: Domain d3be1l1: 3be1 L:1-107

Lineage for d3be1l1 (3be1 L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3be1l1: 3be1 L:1-107 [208627]
   Other proteins in same PDB: d3be1a1, d3be1a2, d3be1a3, d3be1a4, d3be1h_, d3be1l2
   automated match to d1rhha1
   complexed with mes, nag

Details for d3be1l1

PDB Entry: 3be1, 2.9 Å

PDB Description: dual specific bh1 fab in complex with the extracellular domain of her2/erbb-2

PDB Compounds: (L:) Fab Fragment-Light Chain

SCOPe Domain Sequences for d3be1l1:

Sequence; same for both SEQRES and ATOM records:

>d3be1l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdiprsisgyvawyqqkpgkapklliywgsylys
gvpsrfsgsgsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik

Timeline for d3be1l1:

• d3be1l1 first appeared in SCOPe 2.03
  
• d3be1l1 appears in SCOPe 2.07