Lineage for d3bdjb5 (3bdj B:537-694)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2551903Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2551904Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2551966Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 2551967Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 2551977Domain d3bdjb5: 3bdj B:537-694 [208625]
    Other proteins in same PDB: d3bdja1, d3bdja2, d3bdja3, d3bdja4, d3bdja6, d3bdjb1, d3bdjb2, d3bdjb3, d3bdjb4, d3bdjb6
    automated match to d1v97a3
    complexed with 141, ca, co3, fad, fes, gol, mow, mte

Details for d3bdjb5

PDB Entry: 3bdj (more details), 2 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase with a Covalently Bound Oxipurinol Inhibitor
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3bdjb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdjb5 d.41.1.1 (B:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOPe Domain Coordinates for d3bdjb5:

Click to download the PDB-style file with coordinates for d3bdjb5.
(The format of our PDB-style files is described here.)

Timeline for d3bdjb5: