| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
| Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
| Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [55453] (11 PDB entries) Uniprot P80457 |
| Domain d3bdjb4: 3bdj B:415-528 [208624] Other proteins in same PDB: d3bdja1, d3bdja2, d3bdja3, d3bdja5, d3bdja6, d3bdjb1, d3bdjb2, d3bdjb3, d3bdjb5, d3bdjb6 automated match to d1v97a4 complexed with 141, ca, co3, fad, fes, gol, mow, mte |
PDB Entry: 3bdj (more details), 2 Å
SCOPe Domain Sequences for d3bdjb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bdjb4 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3bdjb4: