Lineage for d3bdjb2 (3bdj B:93-164)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000915Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2000916Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2000917Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2000976Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 2000977Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
    Uniprot P80457
  8. 2000989Domain d3bdjb2: 3bdj B:93-164 [208622]
    Other proteins in same PDB: d3bdja1, d3bdja3, d3bdja4, d3bdja5, d3bdja6, d3bdjb1, d3bdjb3, d3bdjb4, d3bdjb5, d3bdjb6
    automated match to d1v97a1
    complexed with 141, ca, co3, fad, fes, gol, mow, mte

Details for d3bdjb2

PDB Entry: 3bdj (more details), 2 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase with a Covalently Bound Oxipurinol Inhibitor
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3bdjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdjb2 a.56.1.1 (B:93-164) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfa

SCOPe Domain Coordinates for d3bdjb2:

Click to download the PDB-style file with coordinates for d3bdjb2.
(The format of our PDB-style files is described here.)

Timeline for d3bdjb2: