![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
![]() | Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) ![]() contains 2Fe-2S cluster |
![]() | Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins) |
![]() | Protein Xanthine oxidase, domain 2 [47746] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries) Uniprot P80457 |
![]() | Domain d3bdjb2: 3bdj B:93-164 [208622] Other proteins in same PDB: d3bdja1, d3bdja3, d3bdja4, d3bdja5, d3bdja6, d3bdjb1, d3bdjb3, d3bdjb4, d3bdjb5, d3bdjb6 automated match to d1v97a1 complexed with 141, ca, co3, fad, fes, gol, mow, mte |
PDB Entry: 3bdj (more details), 2 Å
SCOPe Domain Sequences for d3bdjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bdjb2 a.56.1.1 (B:93-164) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg yrpilqgfrtfa
Timeline for d3bdjb2: