Lineage for d3bdjb1 (3bdj B:3-92)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638761Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1638928Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1639062Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 1639063Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. 1639071Domain d3bdjb1: 3bdj B:3-92 [208621]
    Other proteins in same PDB: d3bdja2, d3bdja3, d3bdja4, d3bdja5, d3bdja6, d3bdjb2, d3bdjb3, d3bdjb4, d3bdjb5, d3bdjb6
    automated match to d1v97a2
    complexed with 141, ca, co3, fad, fes, gol, mow, mte

Details for d3bdjb1

PDB Entry: 3bdj (more details), 2 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase with a Covalently Bound Oxipurinol Inhibitor
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3bdjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdjb1 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3bdjb1:

Click to download the PDB-style file with coordinates for d3bdjb1.
(The format of our PDB-style files is described here.)

Timeline for d3bdjb1: