![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Xanthine oxidase, N-terminal domain [54318] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries) Uniprot P80457 |
![]() | Domain d3bdjb1: 3bdj B:3-92 [208621] Other proteins in same PDB: d3bdja2, d3bdja3, d3bdja4, d3bdja5, d3bdja6, d3bdjb2, d3bdjb3, d3bdjb4, d3bdjb5, d3bdjb6 automated match to d1v97a2 complexed with 141, ca, co3, fad, fes, gol, mow, mte |
PDB Entry: 3bdj (more details), 2 Å
SCOPe Domain Sequences for d3bdjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bdjb1 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq dkiihfsanaclapictlhhvavttvegig
Timeline for d3bdjb1: