Lineage for d1c16g1 (1c16 G:181-276)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358125Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
    gamma, delta T-cell ligand
  7. 2358136Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries)
  8. 2358140Domain d1c16g1: 1c16 G:181-276 [20862]
    Other proteins in same PDB: d1c16a2, d1c16b_, d1c16c2, d1c16d_, d1c16e2, d1c16f_, d1c16g2, d1c16h_

Details for d1c16g1

PDB Entry: 1c16 (more details), 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22
PDB Compounds: (G:) MHC-like protein t22

SCOPe Domain Sequences for d1c16g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c16g1 b.1.1.2 (G:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

SCOPe Domain Coordinates for d1c16g1:

Click to download the PDB-style file with coordinates for d1c16g1.
(The format of our PDB-style files is described here.)

Timeline for d1c16g1: