Lineage for d3bdja3 (3bdj A:193-414)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987556Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2987594Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 2987595Species Cow (Bos taurus) [TaxId:9913] [56192] (10 PDB entries)
    Uniprot P80457
  8. 2987604Domain d3bdja3: 3bdj A:193-414 [208617]
    Other proteins in same PDB: d3bdja1, d3bdja2, d3bdja4, d3bdja5, d3bdja6, d3bdjb1, d3bdjb2, d3bdjb4, d3bdjb5, d3bdjb6
    automated match to d1v97a6
    complexed with 141, ca, co3, fad, fes, gol, mow, mte

Details for d3bdja3

PDB Entry: 3bdj (more details), 2 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase with a Covalently Bound Oxipurinol Inhibitor
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3bdja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdja3 d.145.1.3 (A:193-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
pslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaqh
peaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvektl
leavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkl
tivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOPe Domain Coordinates for d3bdja3:

Click to download the PDB-style file with coordinates for d3bdja3.
(The format of our PDB-style files is described here.)

Timeline for d3bdja3: