SCOPe 2.08: Domain d3bd4b_: 3bd4 B:

Lineage for d3bd4b_ (3bd4 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3bd4b_: 3bd4 B: [208612]
   automated match to d1eeqa_
   protein/DNA complex; complexed with btb, cd

Details for d3bd4b_

PDB Entry: 3bd4, 2.4 Å

PDB Description: Crystal structure of single domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals

PDB Compounds: (B:) catalytic antibody

SCOPe Domain Sequences for d3bd4b_:

Sequence, based on SEQRES records:

>d3bd4b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleik

Sequence, based on observed residues (ATOM records):

>d3bd4b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsytfgsgtkleik

Timeline for d3bd4b_:

• d3bd4b_ first appeared in SCOPe 2.03
  
• d3bd4b_ appears in SCOPe 2.07