Lineage for d3bd4a_ (3bd4 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290351Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)
  8. 1290442Domain d3bd4a_: 3bd4 A: [208611]
    automated match to d1eeqa_
    protein/DNA complex; complexed with btb, cd

Details for d3bd4a_

PDB Entry: 3bd4 (more details), 2.4 Å

PDB Description: Crystal structure of single domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals
PDB Compounds: (A:) catalytic antibody

SCOPe Domain Sequences for d3bd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bd4a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleik

SCOPe Domain Coordinates for d3bd4a_:

Click to download the PDB-style file with coordinates for d3bd4a_.
(The format of our PDB-style files is described here.)

Timeline for d3bd4a_: