Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC homolog, alpha-3 domain [88610] (4 species) gamma, delta T-cell ligand |
Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (1 PDB entry) |
Domain d1c16e1: 1c16 E:181-276 [20860] Other proteins in same PDB: d1c16a2, d1c16b_, d1c16c2, d1c16d_, d1c16e2, d1c16f_, d1c16g2, d1c16h_ |
PDB Entry: 1c16 (more details), 3.1 Å
SCOP Domain Sequences for d1c16e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c16e1 b.1.1.2 (E:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22} rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt fqkwaavvvplgkeqsytchvyheglpeplilrwgg
Timeline for d1c16e1: