SCOPe 2.08: Domain d3ba7a1: 3ba7 A:1G-137

Lineage for d3ba7a1 (3ba7 A:1G-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d3ba7a1: 3ba7 A:1G-137 [208585]
   Other proteins in same PDB: d3ba7a2, d3ba7b2
   automated match to d1q03a_
   complexed with fmt, so4; mutant

Details for d3ba7a1

PDB Entry: 3ba7, 1.6 Å

PDB Description: crystal structure of l26n/d28a mutant of human acidic fibroblast growth factor

PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3ba7a1:

Sequence; same for both SEQRES and ATOM records:

>d3ba7a1 b.42.1.1 (A:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrinpagtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
prthygqkailflplpv

Timeline for d3ba7a1:

• d3ba7a1 first appeared in SCOPe 2.03, called d3ba7a_
  
• d3ba7a1 appears in SCOPe 2.07