Lineage for d3ba4b_ (3ba4 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316303Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1316304Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1316305Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1316319Species Human (Homo sapiens) [TaxId:9606] [50359] (78 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1316368Domain d3ba4b_: 3ba4 B: [208578]
    automated match to d1q03a_
    complexed with fmt, so4; mutant

Details for d3ba4b_

PDB Entry: 3ba4 (more details), 1.8 Å

PDB Description: crystal structure of l26d mutant of human acidic fibroblast growth factor
PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3ba4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ba4b_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhhfnlppgnykkpkllycsngghflridpdgtvdgtrdrsdqhiqlqlsaesvgevy
ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
sckrgprthygqkailflplpvss

SCOPe Domain Coordinates for d3ba4b_:

Click to download the PDB-style file with coordinates for d3ba4b_.
(The format of our PDB-style files is described here.)

Timeline for d3ba4b_: