Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.0: automated matches [191510] (1 protein) not a true family |
Protein automated matches [190849] (8 species) not a true protein |
Species Geobacillus thermodenitrificans [TaxId:33940] [225395] (2 PDB entries) |
Domain d3b9ob_: 3b9o B: [208575] automated match to d3sdoa_ complexed with fmn |
PDB Entry: 3b9o (more details), 1.9 Å
SCOPe Domain Sequences for d3b9ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9ob_ c.1.16.0 (B:) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]} kkihinafemncvghiahglwrhpenqrhrytdlnywtelaqllekgkfdalfladvvgi ydvyrqsrdtavreavqipvndplmlisamayvtkhlafavtfsttyehpygharrmstl dhltkgriawnvvtshlpsadknfgikkilehderydladeylevcyklwegswednavi rdienniytdpskvheinhsgkyfevpgphlcepspqrtpviyqagmsergrefaakhae cvflggkdvetlkffvddirkrakkygrnpdhikmfagicvivgkthdeameklnsfqky wsleghlahygggtgydlskyssndyigsisvgeiinnmskldgkwfklsvgtpkkvade mqylveeagidgfnlvqyvspgtfvdfielvvpelqkrglyrvdyeegtyreklfgkgny rlpddhiaaryrn
Timeline for d3b9ob_: