SCOPe 2.08: Domain d3b9ob_: 3b9o B:

Lineage for d3b9ob_ (3b9o B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families)
   consists of clearly related families of somewhat different folds

5. Family c.1.16.0: automated matches [191510] (1 protein)
   not a true family

6. Protein automated matches [190849] (11 species)
   not a true protein

7. Species Geobacillus thermodenitrificans [TaxId:33940] [225395] (2 PDB entries)

8. Domain d3b9ob_: 3b9o B: [208575]
   automated match to d3sdoa_
   complexed with fmn

Details for d3b9ob_

PDB Entry: 3b9o, 1.9 Å

PDB Description: long-chain alkane monooxygenase (LadA) in complex with coenzyme FMN

PDB Compounds: (B:) Alkane monoxygenase

SCOPe Domain Sequences for d3b9ob_:

Sequence; same for both SEQRES and ATOM records:

>d3b9ob_ c.1.16.0 (B:) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
kkihinafemncvghiahglwrhpenqrhrytdlnywtelaqllekgkfdalfladvvgi
ydvyrqsrdtavreavqipvndplmlisamayvtkhlafavtfsttyehpygharrmstl
dhltkgriawnvvtshlpsadknfgikkilehderydladeylevcyklwegswednavi
rdienniytdpskvheinhsgkyfevpgphlcepspqrtpviyqagmsergrefaakhae
cvflggkdvetlkffvddirkrakkygrnpdhikmfagicvivgkthdeameklnsfqky
wsleghlahygggtgydlskyssndyigsisvgeiinnmskldgkwfklsvgtpkkvade
mqylveeagidgfnlvqyvspgtfvdfielvvpelqkrglyrvdyeegtyreklfgkgny
rlpddhiaaryrn

Timeline for d3b9ob_:

• d3b9ob_ first appeared in SCOPe 2.03
  
• d3b9ob_ appears in SCOPe 2.07