Lineage for d3b97c1 (3b97 C:1-139)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555155Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries)
  8. 2555164Domain d3b97c1: 3b97 C:1-139 [208566]
    Other proteins in same PDB: d3b97a2, d3b97b2, d3b97c2, d3b97d2
    automated match to d1pdza2
    complexed with mg, so4

Details for d3b97c1

PDB Entry: 3b97 (more details), 2.2 Å

PDB Description: Crystal Structure of human Enolase 1
PDB Compounds: (C:) Alpha-enolase

SCOPe Domain Sequences for d3b97c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b97c1 d.54.1.0 (C:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
gavekgvplyrhiadlagn

SCOPe Domain Coordinates for d3b97c1:

Click to download the PDB-style file with coordinates for d3b97c1.
(The format of our PDB-style files is described here.)

Timeline for d3b97c1: