| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
| Protein automated matches [226973] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225520] (3 PDB entries) |
| Domain d3b97b2: 3b97 B:140-432 [208565] Other proteins in same PDB: d3b97a1, d3b97b1, d3b97c1, d3b97d1 automated match to d1pdza1 complexed with mg, so4 |
PDB Entry: 3b97 (more details), 2.2 Å
SCOPe Domain Sequences for d3b97b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b97b2 c.1.11.1 (B:140-432) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevilpvpafnvinggshagnklamqefmilpvgaanfreamrigaevyhnlknvikeky
gkdatnvgdeggfapnilenkeglellktaigkagytdkvvigmdvaaseffrsgkydld
fkspddpsryispdqladlyksfikdypvvsiedpfdqddwgawqkftasagiqvvgddl
tvtnpkriakavnekscnclllkvnqigsvteslqacklaqangwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqllrieeelgskakfagrnfrnpla
Timeline for d3b97b2: