Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries) |
Domain d3b97b1: 3b97 B:1-139 [208564] Other proteins in same PDB: d3b97a2, d3b97b2, d3b97c2, d3b97d2 automated match to d1pdza2 complexed with mg, so4 |
PDB Entry: 3b97 (more details), 2.2 Å
SCOPe Domain Sequences for d3b97b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b97b1 d.54.1.0 (B:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]} silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka gavekgvplyrhiadlagn
Timeline for d3b97b1: