Lineage for d3b97b1 (3b97 B:1-139)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413129Species Human (Homo sapiens) [TaxId:9606] [225519] (2 PDB entries)
  8. 1413133Domain d3b97b1: 3b97 B:1-139 [208564]
    Other proteins in same PDB: d3b97a2, d3b97b2, d3b97c2, d3b97d2
    automated match to d1pdza2
    complexed with mg, so4

Details for d3b97b1

PDB Entry: 3b97 (more details), 2.2 Å

PDB Description: Crystal Structure of human Enolase 1
PDB Compounds: (B:) Alpha-enolase

SCOPe Domain Sequences for d3b97b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b97b1 d.54.1.0 (B:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
gavekgvplyrhiadlagn

SCOPe Domain Coordinates for d3b97b1:

Click to download the PDB-style file with coordinates for d3b97b1.
(The format of our PDB-style files is described here.)

Timeline for d3b97b1: