Lineage for d3b8ax2 (3b8a X:225-485)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2884847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)
  8. 2884861Domain d3b8ax2: 3b8a X:225-485 [208561]
    automated match to d1ig8a2
    complexed with bgc, so4

Details for d3b8ax2

PDB Entry: 3b8a (more details), 2.95 Å

PDB Description: crystal structure of yeast hexokinase pi in complex with glucose
PDB Compounds: (X:) Hexokinase-1

SCOPe Domain Sequences for d3b8ax2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8ax2 c.55.1.0 (X:225-485) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
etkmgvifgtgvngafydvvsdieklegkladdipsnspmainceygsfdnehlvlprtk
ydvavdeqsprpgqqafekmtsgyylgellrlvllelnekglmlkdqdlsklkqpyimdt
syparieddpfenledtddifqkdfgvkttlperklirrlceligtraarlavcgiaaic
qkrgyktghiaadgsvynkypgfkeaaakglrdiygwtgdaskdpitivpaedgsgagaa
viaalsekriaegkslgiiga

SCOPe Domain Coordinates for d3b8ax2:

Click to download the PDB-style file with coordinates for d3b8ax2.
(The format of our PDB-style files is described here.)

Timeline for d3b8ax2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b8ax1