![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein MHC I homolog [48967] (3 species) gamma, delta T-cell ligand |
![]() | Species Mouse (Mus musculus), t22 [TaxId:10090] [48969] (1 PDB entry) |
![]() | Domain d1c16a1: 1c16 A:181-276 [20856] Other proteins in same PDB: d1c16a2, d1c16c2, d1c16e2, d1c16g2 |
PDB Entry: 1c16 (more details), 3.1 Å
SCOP Domain Sequences for d1c16a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c16a1 b.1.1.2 (A:181-276) MHC I homolog {Mouse (Mus musculus), t22} rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt fqkwaavvvplgkeqsytchvyheglpeplilrwgg
Timeline for d1c16a1: