Lineage for d1c16a1 (1c16 A:181-276)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 104600Protein MHC I homolog [48967] (2 species)
  7. 104604Species Mouse (Mus musculus), t22 [TaxId:10090] [48969] (1 PDB entry)
  8. 104605Domain d1c16a1: 1c16 A:181-276 [20856]
    Other proteins in same PDB: d1c16a2, d1c16c2, d1c16e2, d1c16g2

Details for d1c16a1

PDB Entry: 1c16 (more details), 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22

SCOP Domain Sequences for d1c16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c16a1 b.1.1.2 (A:181-276) MHC I homolog {Mouse (Mus musculus), t22}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

SCOP Domain Coordinates for d1c16a1:

Click to download the PDB-style file with coordinates for d1c16a1.
(The format of our PDB-style files is described here.)

Timeline for d1c16a1: