| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) ![]() automatically mapped to Pfam PF00650 |
| Family c.13.1.0: automated matches [227225] (1 protein) not a true family |
| Protein automated matches [226966] (3 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225409] (5 PDB entries) |
| Domain d3b7za2: 3b7z A:95-310 [208559] Other proteins in same PDB: d3b7za1 automated match to d1auaa2 complexed with 6pl, b7n |
PDB Entry: 3b7z (more details), 2.03 Å
SCOPe Domain Sequences for d3b7za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7za2 c.13.1.0 (A:95-310) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
keaedkeriklakmypqyyhhvdkdgrplyfeelgginlkkmykittekqmlrnlvkeye
lfatyrvpacsrragylietsctvldlkgislsnayhvlsyikdvadisqnyypermgkf
yiihspfgfstmfkmvkpfldpvtvskifilgssykkellkqipienlpvkyggtsvlhn
pndkfyysdigpwrdpryigpegeipnifgkftvts
Timeline for d3b7za2: