SCOPe 2.06: Domain d3b7yb_: 3b7y B:

Lineage for d3b7yb_ (3b7y B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (22 PDB entries)

8. Domain d3b7yb_: 3b7y B: [208557]
   automated match to d3kwta_
   complexed with ca

Details for d3b7yb_

PDB Entry: 3b7y, 1.8 Å

PDB Description: Crystal structure of the C2 Domain of the E3 Ubiquitin-Protein Ligase NEDD4

PDB Compounds: (B:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d3b7yb_:

Sequence, based on SEQRES records:

>d3b7yb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atcavevfglledeensrivrvrviagiglakkdilgasdpyvrvtlydpmngvltsvqt
ktikkslnpkwneeilfrvhpqqhrllfevfdenrltrddflgqvdvplyplptenprle
rpytfkdfvlhprshksrvkgylrlkmtylp

Sequence, based on observed residues (ATOM records):

>d3b7yb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atcavevfglledeensrivrvrviagiglakkdilgasdpyvrvtlydpmngvltsvqt
ktikkslnpkwneeilfrvhpqqhrllfevfdenrltrddflgqvdvplyplptenpytf
kdfvlhprshksrvkgylrlkmtylp

Timeline for d3b7yb_:

• d3b7yb_ first appeared in SCOPe 2.03
  
• d3b7yb_ appears in SCOPe 2.05
  
• d3b7yb_ appears in SCOPe 2.07
  
• d3b7yb_ appears in the current release, SCOPe 2.08