Lineage for d3b7xa_ (3b7x A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408643Species Human (Homo sapiens) [TaxId:9606] [225017] (6 PDB entries)
  8. 1408654Domain d3b7xa_: 3b7x A: [208555]
    automated match to d3ni6b_

Details for d3b7xa_

PDB Entry: 3b7x (more details), 2.1 Å

PDB Description: Crystal structure of human FK506-Binding Protein 6
PDB Compounds: (A:) FK506-binding protein 6

SCOPe Domain Sequences for d3b7xa_:

Sequence, based on SEQRES records: (download)

>d3b7xa_ d.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qslyerlsqrmldisgdrgvlkdviregagdlvapdasvlvkysgylehmdrpfdsnyfr
ktprlmklgeditlwgmelgllsmrrgelarflfkpnyaygtlgcpplippnttvlfeie
lldfl

Sequence, based on observed residues (ATOM records): (download)

>d3b7xa_ d.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qslyerlsqrmldisgdrgvlkdviregagdlvapdasvlvkysgylehmdrpfdsnlmk
leditlwgmelgllsmrrgelarflfkpnyaygtlgcpplippnttvlfeielldfl

SCOPe Domain Coordinates for d3b7xa_:

Click to download the PDB-style file with coordinates for d3b7xa_.
(The format of our PDB-style files is described here.)

Timeline for d3b7xa_: