Lineage for d3b7na2 (3b7n A:95-310)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111988Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2111989Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2112023Family c.13.1.0: automated matches [227225] (1 protein)
    not a true family
  6. 2112024Protein automated matches [226966] (2 species)
    not a true protein
  7. 2112025Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225409] (5 PDB entries)
  8. 2112026Domain d3b7na2: 3b7n A:95-310 [208550]
    Other proteins in same PDB: d3b7na1
    automated match to d1auaa2
    complexed with act, b7n, po4

Details for d3b7na2

PDB Entry: 3b7n (more details), 1.86 Å

PDB Description: crystal structure of yeast sec14 homolog sfh1 in complex with phosphatidylinositol
PDB Compounds: (A:) Uncharacterized protein YKL091C

SCOPe Domain Sequences for d3b7na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7na2 c.13.1.0 (A:95-310) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
keaedkeriklakmypqyyhhvdkdgrplyfeelgginlkkmykittekqmlrnlvkeye
lfatyrvpacsrragylietsctvldlkgislsnayhvlsyikdvadisqnyypermgkf
yiihspfgfstmfkmvkpfldpvtvskifilgssykkellkqipienlpvkyggtsvlhn
pndkfyysdigpwrdpryigpegeipnifgkftvts

SCOPe Domain Coordinates for d3b7na2:

Click to download the PDB-style file with coordinates for d3b7na2.
(The format of our PDB-style files is described here.)

Timeline for d3b7na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b7na1