SCOP 1.65: Domain d1b3ja1: 1b3j A:181-274

Lineage for d1b3ja1 (1b3j A:181-274)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC homolog, alpha-3 domain [88610] (3 species)
   gamma, delta T-cell ligand

7. Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries)

8. Domain d1b3ja1: 1b3j A:181-274 [20855]
   Other proteins in same PDB: d1b3ja2
   complexed with nag

Details for d1b3ja1

PDB Entry: 1b3j, 3 Å

PDB Description: structure of the mhc class i homolog mic-a, a gammadelta t cell ligand

SCOP Domain Sequences for d1b3ja1:

Sequence; same for both SEQRES and ATOM records:

>d1b3ja1 b.1.1.2 (A:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a}
tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt
yqtwvatricqgeeqrftcymehsgnhsthpvps

Timeline for d1b3ja1:

• d1b3ja1 first appeared (with stable ids) in SCOP 1.55
  
• d1b3ja1 appears in SCOP 1.63
  
• d1b3ja1 appears in SCOP 1.67
  
• d1b3ja1 appears in the current release, SCOPe 2.08