Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein MHC I homolog [48967] (3 species) gamma, delta T-cell ligand |
Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries) |
Domain d1b3ja1: 1b3j A:181-274 [20855] Other proteins in same PDB: d1b3ja2 complexed with nag |
PDB Entry: 1b3j (more details), 3 Å
SCOP Domain Sequences for d1b3ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3ja1 b.1.1.2 (A:181-274) MHC I homolog {Human (Homo sapiens), Mic-a} tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt yqtwvatricqgeeqrftcymehsgnhsthpvps
Timeline for d1b3ja1: