![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC homolog, alpha-3 domain [88610] (4 species) gamma, delta T-cell ligand |
![]() | Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries) |
![]() | Domain d1b3ja1: 1b3j A:181-274 [20855] Other proteins in same PDB: d1b3ja2 |
PDB Entry: 1b3j (more details), 3 Å
SCOPe Domain Sequences for d1b3ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3ja1 b.1.1.2 (A:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt yqtwvatricqgeeqrftcymehsgnhsthpvps
Timeline for d1b3ja1: