SCOPe 2.04: Domain d3b7na1: 3b7n A:4-94

Lineage for d3b7na1 (3b7n A:4-94)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.0: automated matches [227224] (1 protein)
   not a true family

6. Protein automated matches [226965] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225408] (5 PDB entries)

8. Domain d3b7na1: 3b7n A:4-94 [208549]
   Other proteins in same PDB: d3b7na2
   automated match to d1auaa1
   complexed with act, b7n, po4

Details for d3b7na1

PDB Entry: 3b7n, 1.86 Å

PDB Description: crystal structure of yeast sec14 homolog sfh1 in complex with phosphatidylinositol

PDB Compounds: (A:) Uncharacterized protein YKL091C

SCOPe Domain Sequences for d3b7na1:

Sequence; same for both SEQRES and ATOM records:

>d3b7na1 a.5.3.0 (A:4-94) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrarkf
dinasvemfveterwreeygantiiedyenn

Timeline for d3b7na1:

• d3b7na1 first appeared in SCOPe 2.03
  
• d3b7na1 appears in SCOPe 2.05
  
• d3b7na1 appears in the current release, SCOPe 2.08